Out Of Order Error In Ab Initio
Technology and Trends Enterprise Architecture and EAI ERP Hardware IT Management and Strategy Java Knowledge Management Linux Networking Oracle PeopleSoft Project and Portfolio Management SAP SCM Security Siebel Storage UNIX Visual Basic Web Design and Development Windows < Back CHOOSE A DISCUSSION GROUP Research Directory TOPICS Database Hardware Networking SAP Security Web Design MEMBERS Paul_Pedant DACREE MarkDeVries VoIP_News Inside-ERP MacProTX Inside-CRM I_am_the_dragon maxwellarnold Michael Meyers-Jouan TerryCurran Chris_Day Andrew.S.Baker Ramnath.Awate JoeTorre Craig Borysowich Locutus Dennis Stevenson DukeGanote Richard iudithm mircea_luca Clinton Jones bracke Nikki Klein AbhaiTripathi Iqbalyk Adrian_Grigoriu bluesguyAZ59 numbersguyPA COMPANIES EdgeWave Sophos Pivotal CRM Wave Direct View All Topics View All Members View All Companies Toolbox for IT Topics Data Warehouse Groups Ask a New Question Ab Initio The Ab Initio group is for the discussion of issues that arise during the implementation, configuration, administration, or daily use of Ab Initio software. Home | Invite Peers | More Data Warehouse Groups Your account is ready. You're now being signed in. Solve problems - It's Free Create your account in seconds E-mail address is taken If this is your account,sign in here Email address Username Between 5 and 30 characters. No spaces please The Profile Name is already in use Password Notify me of new activity in this group: Real Time Daily Never Keep me informed of the latest: White Papers Newsletter Jobs By clicking "Join Now", you agree to Toolbox for Technology terms of use, and have read and understand our privacy policy. "Out-of-order record found" error ? sunnyc asked Aug 13, 2004 | Replies (4) Hi What is a "Out-of-order record found" error ? Execution starting... ¾¾¾¾¾¾¾¾¾¾¾¾¾¾¾¾¾¾¾¾¾¾¾¾¾¾¾¾¾¾¾¾¾¾¾¾¾¾¾¾¾¾¾¾¾¾ ¾¾¾¾ Error from Component '6_ABC_D_load.6_5_1_Dedup_Sorted_by_ID_cols_1', Partition 0 [U120] Out-of-order record found, record 2 [record .. .. i_id N
Technology and Trends Enterprise Architecture and EAI ERP Hardware IT Management and Strategy Java Knowledge Management Linux Networking Oracle PeopleSoft Project and Portfolio Management SAP SCM Security Siebel Storage UNIX Visual Basic Web Design and Development Windows < Back CHOOSE A DISCUSSION GROUP Research Directory TOPICS Database Hardware Networking SAP Security Web Design MEMBERS Paul_Pedant DACREE MarkDeVries Inside-ERP Inside-CRM VoIP_News MacProTX I_am_the_dragon maxwellarnold Michael Meyers-Jouan TerryCurran Chris_Day http://datawarehouse.ittoolbox.com/groups/technical-functional/abinitio-l/outoforder-record-found-error-529549 Andrew.S.Baker Ramnath.Awate JoeTorre Craig Borysowich Locutus Dennis Stevenson DukeGanote Richard iudithm mircea_luca Clinton Jones bracke Nikki Klein AbhaiTripathi Adrian_Grigoriu Iqbalyk numbersguyPA RichardChan COMPANIES EdgeWave Sophos Pivotal CRM Wave Direct View All Topics View All Members View All Companies Toolbox for IT Topics Data Warehouse Groups Ask a New Question Ab Initio http://datawarehouse.ittoolbox.com/groups/technical-functional/abinitio-l/out-of-order-record-555036 The Ab Initio group is for the discussion of issues that arise during the implementation, configuration, administration, or daily use of Ab Initio software. Home | Invite Peers | More Data Warehouse Groups Your account is ready. You're now being signed in. Solve problems - It's Free Create your account in seconds E-mail address is taken If this is your account,sign in here Email address Username Between 5 and 30 characters. No spaces please The Profile Name is already in use Password Notify me of new activity in this group: Real Time Daily Never Keep me informed of the latest: White Papers Newsletter Jobs By clicking "Join Now", you agree to Toolbox for Technology terms of use, and have read and understand our privacy policy. Out of order record JR asked Sep 22, 2004 | Replies (13) I don't know if any of you have run into this but we have run
error: ERROR: Value of inactive option accessed: -in:file:frag9 12 posts https://www.rosettacommons.org/content/abinitio-error-error-value-inactive-option-accessed-infilefrag9 / 0 new Log in or register to post comments Last post Abinitio error: ERROR: Value of inactive option accessed: -in:file:frag9 #1 Top I hope this isn't a repost but I couldn't find anything here, I found a similar post on minirosetta but it out of wasn't solved. I built Rosetta and tried to run abinitio in the rosetta_demos using this command /rosetta3.4/rosetta_demos/abinitio$ ../../rosetta_source/bin/AbinitioRelax.linuxgccrelease -in::file::fasta ./input_files/1elwA.fasta this is my script: core.init: Mini-Rosetta version unknown from unknown core.init: command: ../../rosetta_source/bin/AbinitioRelax.linuxgccrelease -in::file::fasta input_files/1elwA.fasta core.init: 'RNG device' seed mode, using '/dev/urandom', seed=390087245 seed_offset=0 real_seed=390087245 out of order core.init.random: RandomGenerator:init: Normal mode, seed=390087245 RG_type=mt19937 core.init: found database environment variable ROSETTA3_DB: /home/yamoahlab/Documents/ryan protein modeling/rosetta3.4/rosetta_database/ protocols.abinitio.AbrelaxApplication: read fasta sequence: 117 residues EQVNELKEKGNKALSVGNIDDALQCYSEAIKLDPHNHVLYSNRSAAYAKKGDYQKAYEDGCKTVDLKPDWGKGYSRKAAALEFLNRFEEAKRTYEEGLKHEANNPQLKEGLQNMEAR protocols.evaluation.ChiWellRmsdEvaluatorCreator: Evaluation Creator active ... core.chemical.ResidueTypeSet: Finished initializing centroid residue type set. Created 1980 residue types ERROR: Value of inactive option accessed: -in:file:frag9 os ubuntu 12.04 LTS rosetta 3.4 downloaded from bundle academic_user not sure if this is important but I just fixed this problem of ROSETTA3_DB not defined by entering this code: export ROSETTA3_DB=/home/yamoahlab/Documents/ryan\ protein\ modeling/rosetta3.4/rosetta_database/ sorry if this is beginner stuff I'm only taken a couple beginner classes and I'm trying to teach myself programming so details would be nice. Thanks for your help in advance Post Situation:Unsolved Tue, 2012-09-18 14:04 rlwoltz Log in or register to post comments #2 Top You haven't passed Rosetta any fragment files. Rose